SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078K763 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078K763
Domain Number 1 Region: 73-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000255
Family Nucleotide and nucleoside kinases 0.011
Further Details:      
 
Weak hits

Sequence:  A0A078K763
Domain Number - Region: 15-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A078K763
Sequence length 274
Comment (tr|A0A078K763|A0A078K763_9APIC) Adenylate kinase-like protein 2, putative {ECO:0000313|EMBL:CDZ11987.1} KW=Complete proteome OX=5861 OS=Plasmodium yoelii. GN=PY17X_0836100 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
METLLDSETLKKYEEETNEYINKKNVEKLFDIIAKNVLINKPDNVYLYIYNNIYSFLLNK
IFIIGPPSLKITSTISSSIANSFDYYHLDVSHLVSSYISSKENDTQDKQSNQILINDDII
CSAVKTHINNLDAKKKRGYVIQDFPKTNLQANSCLQYLPSHVFVLIADEEYIYKKYEEEN
NVKIILDTNNQIYDEQSNLFEIKEISTHPLEEKVKEYLRCIPGVLEVIGNNKNVINLRDF
DEINVVDQVMNMVAKNKDEWNSLFSDDISDKDQK
Download sequence
Identical sequences A0A078K763 V7PNY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]