SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078L4J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078L4J2
Domain Number 1 Region: 155-213
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000222
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078L4J2
Sequence length 228
Comment (tr|A0A078L4J2|A0A078L4J2_9CHLA) Uncharacterized protein {ECO:0000313|EMBL:CDZ81625.1} KW=Complete proteome; Reference proteome OX=1444712 OS=Candidatus Rubidus massiliensis. GN=BN1013_02161 OC=Bacteria; Chlamydiae; Chlamydiales; Chlamydiaceae; Candidatus Rubidus.
Sequence
MQPIGRNIFRQSKQVSFFSTKKSPCQISSLFAKETSKQSLKSLWKFQKRNYSYARDALRS
VAISYAISLGVSTIGAVGYVLVYTPLKENHEVKKIAKLQEIERANALLEICKKEQVTLLS
KCLEVFEVDKKLVNVCLKNVLEEQKTKKTKELLFILVKHGAEANPELLTFAIEEESCDLV
NLLIDKGVDVNKKHVEKAIKQGNGSILNSLSKNEKARKILFQAVKTNA
Download sequence
Identical sequences A0A078L4J2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]