SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078MRS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078MRS5
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000216
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078MRS5
Sequence length 141
Comment (tr|A0A078MRS5|A0A078MRS5_9MICC) Uncharacterized protein {ECO:0000313|EMBL:CEA08989.1} OX=1461584 OS=Arthrobacter saudimassiliensis. GN=BN1051_02352 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
MSDMFLDKFRDLVPKYLEDRWRTEDGIPAPELDGILAERELRIPLVLREFYLAIGGCDDL
MEAYHFFWDPDELEIEDGYLLFLEDEDEKFVWGFRADQLDVPDPIVWRRNNARGTWKSEE
GTFSEFVFDMFNWIFEEADEL
Download sequence
Identical sequences A0A078MRS5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]