SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078PNM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A078PNM4
Domain Number - Region: 300-370
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00196
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078PNM4
Sequence length 622
Comment (tr|A0A078PNM4|A0A078PNM4_BACOV) Uncharacterized protein {ECO:0000313|EMBL:KDS11801.1} KW=Complete proteome OX=1339346 OS=Bacteroides ovatus str. 3725 D1 iv. GN=M088_3809 OC=Bacteroides.
Sequence
MRIISYISSIIITFFALAIMSGCKDSEVVDDGFRTTMAKASDVKLNKVAYWPGDPVNCSF
TLKNETNYPMDIREVKVVIQNLDDGGCVLIEKSVASHIQIEPGQSVPVDAGTLYTLPAAL
KPSSFCAVRFLLDFEDGITTTIDGTYFRAVNEQSLLTYDIQKLDYQGLPVYRQIGDMSAG
FGVLKTIVAFDQGIAATMEEAPQGGTYPVAPTPEFLQRSVRKTVELYNSEIGAATKIKRV
VVGTGIASVSYFATMMGAAYLPIHYLVSANSASEVQAILDYSNQNGYASYATLGYDGSMP
GVGVAWIKLLDLPEEYKQFIKDHQVEEVYIYGVGQEGHGESYSRRVLTQNTITDEYAPGS
LYILYTNFGSDADIDALKHRLYDYNQLKLGEGQYISDWESGIVDDQITNISGSAQAMANV
KAYTIETDDMMALYNISSFLTLQYIKKNQSKLQAPFVNGVIFNEYLTNHPQYEAFVGYVP
LLYWQFNSAASTVERIDGYLKPAIAGYFPDVVDHLYEGSFYLNSNMRRYEFYDELIARGV
TSENIRIRQSVDKWNPEDDGETEEYLGRINHKIGSAEEFAYDIIERIGVQKYRNTVKSME
YLTLEELRTICAQVGNMRLVEH
Download sequence
Identical sequences A0A078PNM4 A0A1F0J379 A0A1Y4PWZ5 A7LTJ2 I8XYW0
WP_004297242.1.16618 WP_004297242.1.17530 WP_004297242.1.20997 WP_004297242.1.21574 WP_004297242.1.37910 WP_004297242.1.4838 WP_004297242.1.49654 WP_004297242.1.49999 WP_004297242.1.665 WP_004297242.1.77561 WP_004297242.1.79560 WP_004297242.1.84276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]