SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078PW46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078PW46
Domain Number 1 Region: 36-85
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000016
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078PW46
Sequence length 114
Comment (tr|A0A078PW46|A0A078PW46_BACOV) Uncharacterized protein {ECO:0000313|EMBL:KDS13837.1} KW=Complete proteome OX=1339346 OS=Bacteroides ovatus str. 3725 D1 iv. GN=M088_2199 OC=Bacteroides.
Sequence
MTETIITAIITALCTGGLTWLFTLRYTRKQAEADAMKSVQEVYQELIEDMKNDRKELKQR
IDDVESQYRELQQKCNEMEKDIRQNARVMDIMKPFLCGVKNCLNRKSITFDTNN
Download sequence
Identical sequences A0A078PW46 A0A078Q7Y4 A0A1F0ITQ2 F7LY53 I8Z1H9 I9PZZ4 I9Q9E3 K5CFN6
WP_004318189.1.20997 WP_004318189.1.26971 WP_004318189.1.29471 WP_004318189.1.33364 WP_004318189.1.3999 WP_004318189.1.45558 WP_004318189.1.4838 WP_004318189.1.49999 WP_004318189.1.52461 WP_004318189.1.66863 WP_004318189.1.77561 WP_004318189.1.84276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]