SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078QDN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078QDN3
Domain Number 1 Region: 10-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000432
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078QDN3
Sequence length 123
Comment (tr|A0A078QDN3|A0A078QDN3_BACFG) Uncharacterized protein {ECO:0000313|EMBL:KDS20481.1} KW=Complete proteome OX=1339286 OS=Bacteroides fragilis str. 3725 D9 ii. GN=M082_1602 OC=Bacteroides.
Sequence
MIADNKEIKKRIIELQAKLNIIFPQLYIDFLAKINDGDVYEVDDSGICLYSYSDLEERNQ
TYQIKDFEPNYFMIGQDGDLGYFINVGNPTDNSIYSNDLGALGSLEMEKESNNIFDFIGQ
NEK
Download sequence
Identical sequences A0A078PVB2 A0A078QDN3 A0A0E2SVG1 A0A0P0GFE7
WP_029427320.1.39634 WP_029427320.1.39779 WP_029427320.1.43461 WP_029427320.1.49999 WP_029427320.1.77561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]