SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080FU23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080FU23
Domain Number 1 Region: 26-160
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 1.01e-57
Family Ecotin, trypsin inhibitor 0.000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080FU23
Sequence length 162
Comment (tr|A0A080FU23|A0A080FU23_ECOLX) Ecotin {ECO:0000256|HAMAP-Rule:MF_00706} KW=Complete proteome OX=1444275 OS=Escherichia coli 1-392-07_S4_C3. GN=AD40_2756 OC=Enterobacteriaceae; Escherichia.
Sequence
MKTILPAVLFAAFATTSAWAAESAQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVEL
LIGQTLEVDCNLHRLGGKLESKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAY
LGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Download sequence
Identical sequences A0A080FU23
WP_001667713.1.101651 WP_001667713.1.112 WP_001667713.1.23765 WP_001667713.1.27283 WP_001667713.1.4740 WP_001667713.1.49987 WP_001667713.1.50715 WP_001667713.1.53356 WP_001667713.1.59395 WP_001667713.1.67549 WP_001667713.1.7015 WP_001667713.1.72186 WP_001667713.1.79526 WP_001667713.1.84060 WP_001667713.1.84486 WP_001667713.1.8652 WP_001667713.1.87205 WP_001667713.1.89396 WP_001667713.1.9491 WP_001667713.1.99632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]