SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080K371 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080K371
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-29
Family SMI1/KNR4-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A080K371
Sequence length 143
Comment (tr|A0A080K371|A0A080K371_9NEIS) Ctf8 {ECO:0000313|EMBL:KES12547.1} KW=Complete proteome; Reference proteome OX=1443104 OS=Snodgrassella alvi SCGC AB-598-P14. GN=SASC598P14_003320 OC=Neisseriaceae; Snodgrassella.
Sequence
MNREKLIELFEKYSDLINMGTSDDAPGNDWIDAAEKALLVKFPADYKWFLNNYGGGDICG
EEIYSIYCLPFNEAVGGDVVYQNMIANNNVESGKIALSNTDFGEEFFFDTNDMEKVYISI
GNNRQLYASDFLEYLQKRLLSYV
Download sequence
Identical sequences A0A080K371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]