SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080K3S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080K3S4
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.98e-27
Family SMI1/KNR4-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A080K3S4
Sequence length 138
Comment (tr|A0A080K3S4|A0A080K3S4_9NEIS) Ctf8 {ECO:0000313|EMBL:KES12747.1} KW=Complete proteome; Reference proteome OX=1445515 OS=Snodgrassella alvi SCGC AB-598-O11. GN=SASC598O11_001370 OC=Neisseriaceae; Snodgrassella.
Sequence
LIELFEKYSDLINMGTSDDTPGNDWIDAAEKVLLVNFPADYKWFLNNYGGGDICGEEIYS
IYCLPFNEAVGGDIVYQNTIANNNLESGKIALSNTDFGEEFFFDTNNMEKVYISIGNNRQ
LYASDFLEYLQKRLLSYV
Download sequence
Identical sequences A0A080K3S4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]