SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080UCW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080UCW3
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.83e-47
Family AadK N-terminal domain-like 0.00000285
Further Details:      
 
Domain Number 2 Region: 138-230
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.43e-39
Family AadK C-terminal domain-like 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A080UCW3
Sequence length 252
Comment (tr|A0A080UCW3|A0A080UCW3_BACIU) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:KFK81885.1} KW=Complete proteome OX=1495315 OS=Bacillus subtilis subsp. niger. GN=DK44_2361 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRSESEMMRLILDLGNRDKRIRLVTLEGSRTNKNVPRDKFQDYDISYFVTDIDSFKSNDE
WLKHFGEMIMMQKPEDMELFPPELGDWFSYLMLFKDDSKIDLTLIPIDQMEQYFSDSDGL
VEVLLDKDLRVKNTITATDERYHIKKPTAREFDDCCNEFWMVSTYVVKGLMRKEILFAWD
HLYEILRPNLLRMISWNIGIQHNFSLSVGKNYKYIQRYMDEKDWGHLLNTCVGDTVDTKK
PGGLNRVKKSVF
Download sequence
Identical sequences A0A080UCW3 A0A0H3E1W9
gi|311068331|ref|YP_003973254.1| WP_003328703.1.100936 WP_003328703.1.10353 WP_003328703.1.15971 WP_003328703.1.16994 WP_003328703.1.32777 WP_003328703.1.39473 WP_003328703.1.39900 WP_003328703.1.40255 WP_003328703.1.59507 WP_003328703.1.62747 WP_003328703.1.68581 WP_003328703.1.69262 WP_003328703.1.70004 WP_003328703.1.72589 WP_003328703.1.72801 WP_003328703.1.7305 WP_003328703.1.7508 WP_003328703.1.79721 WP_003328703.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]