SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ULU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080ULU1
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.53e-21
Family SMI1/KNR4-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A080ULU1
Sequence length 177
Comment (tr|A0A080ULU1|A0A080ULU1_BACIU) SMI1-KNR4 cell-wall family protein {ECO:0000313|EMBL:KFK83858.1} KW=Complete proteome OX=1495315 OS=Bacillus subtilis subsp. niger. GN=DK44_2117 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEEGKLVHMTLGGIKKAVSKYGTFPMFHHGGHVMEDATFHFRDPANPQEVTNLEKKLGVS
VPNDYKEFLFKHNGMEMFNGVELLSTEGIIEYNEVQDFPKEYVLIGYHYDGRYVIDTNKS
RNGLGYMLYLDSIDDIEDAVNLDSNFEIWFDMLVSSNGTKYWEVSPNIQEYYKLVSE
Download sequence
Identical sequences A0A080ULU1 A0A0H3E420
gi|311068567|ref|YP_003973490.1| WP_003325843.1.100936 WP_003325843.1.15971 WP_003325843.1.39473 WP_003325843.1.62747 WP_003325843.1.7305 WP_003325843.1.79721 WP_003325843.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]