SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080Z068 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080Z068
Domain Number 1 Region: 453-578
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.77e-28
Family Regulator of G-protein signaling, RGS 0.00067
Further Details:      
 
Domain Number 2 Region: 182-311
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-27
Family cAMP-binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 321-440
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000144
Family cAMP-binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A080Z068
Sequence length 643
Comment (tr|A0A080Z068|A0A080Z068_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO60029.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_21731 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MGCVCGTQANRYVEVRRVFDGSLFLQLIGADSSTQAITLRKAESSSHRASIQAQSGQIAV
IFDGCVSLFDANGKNTLSIRAFMPLGRTHVVVPHSPGHAYEVGAHLQDSEVLLTSEVFLF
WKSEKEVICRYVTDGGGEEVVLQSTMCARVELQNQSRYLLLPPQLLPDNKKDSSLNALTN
ADFIGLLGTIPFFANLPIDKLAVLTEMSTIRVYPSNSIIFREDEGISTQMFVTLTGSVEV
TSSRATGSLATLEAGSFFGEMSLLINIPRAATVKALESCMLMSIEKKAFHSLLDQCPDVR
LGVNKLLKERLLLKAILSGVLPFFDSIPNERMIRFSHELDIEDQIHKGDTVLRQQDENDT
EESKFVFIVYGAVEITSNHRKTSKFGHDSTVFLPPGCYLGQFTFERMNVTKGKAFARSSA
VLLTCSFSKVLELFEEYPAAGAAANIAWFGERCDFASVLRHGVLTQRFQTFLESEHSDEN
YLFFLEIEKFRVIGDENERRVASNHIREWYIQSDAPKEVNLPAIIRDGILEKMDKLSPTG
IVETTFFDEACDEIMRLMVKDSFPRFKKSLHFQNIVDTLDPHTNRKGSRLIAACHHFRDS
LQVLRPGHVDMKHMQLERMMSTIQKSQARRNVSGLASPQQENR
Download sequence
Identical sequences A0A080Z068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]