SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080Z275 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080Z275
Domain Number 1 Region: 189-535
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-22
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 36-231
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000458
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A080Z275
Sequence length 642
Comment (tr|A0A080Z275|A0A080Z275_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO60736.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_21127 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLQSVEISLQHDNRVLALEQSSGVISRYLGPPILLPFHEACRFGSTILLDWIWNECPTRK
DARKSFWCLTNYLRSDPYYHRWQFEKSLEVAASRGDLHIVKWLFEHFSGCEAPESVVYDA
VRKGHLCVLQFLWGRRSGQRSHPECSVRLSPGWLRRKPRWGATAMKKKTVENDQLLQCLD
ELGSDDLKSAIKYALEIGDTELAQSLVPVGKCVLDYATGCSHVEVVNWLLDCGYLRLDAQ
LAVSAIENVALRGSLELLQQIFQLHSPLPDNHEHWAKAWGYAILAACTRGHVAIVQWLVE
HHLRREACENISTYEPHSAPLALAAKEGHVAVMQYLFDQGLTDGSLLAMHNAIDKGQVSS
VEWLLGHFPFDEYRKTGEAIDKSAEYGHLAMLEFFHEVDSTMSYEDVETKRRRIDPPISW
WVHAKDPIYWAAKSGHIEILEWIEANRSQKCLPDSIDIAAKYGHLEVTKWLHQHRTEGCT
NMILVQAAKLGHLDVVQWLHLNCPEKCSSEAMYVAAENGHSATVKWLYLNCPNSHTNQAV
DRAIHSGYFQVACWLQARFPDYKIGNLLAYQKPLVDVGDPLDSASFEMLLCLHVRFNDVF
TSHFLELLRKNLLFYGGRYRPVLDHISNWVDENYPTSPMNTS
Download sequence
Identical sequences A0A080Z275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]