SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZBS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080ZBS4
Domain Number 1 Region: 174-238
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000102
Family Chromo domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A080ZBS4
Sequence length 251
Comment (tr|A0A080ZBS4|A0A080ZBS4_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO64085.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_18333 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
IVFMVTRHPYLVHGWDPRSTLEAAIPLGSTRRRDREPRRWRYHIQKHYQQAREQVNGRLH
EAIQGRADRHNEATRSHKLEVGSQVWLYLDRVKEGYARKLAHMWHEPFRVAEVVDLHAVR
LEIAGSDYHVFSVVHVSKLKLVRRFPDRPNVRLMTQDRDRLDFDEGLLPEDSWDTELDEG
EYEVERTSDERTGRRTRYGRKLREFLVLWKGYDDPTWVDEADLNCGALQYDYLRDHINRS
RFGVMQSHEEQ
Download sequence
Identical sequences A0A080ZBS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]