SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZBT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A080ZBT8
Domain Number - Region: 150-217
Classification Level Classification E-value
Superfamily OmpH-like 0.00575
Family OmpH-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A080ZBT8
Sequence length 244
Comment (tr|A0A080ZBT8|A0A080ZBT8_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO64099.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_18320 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSTPVVPAPAPSCLLVWLLPEAFTSISRLLLAPLPSLPRGGHATVSTRPIPHWISPTCAL
RCTLQRTIYQTEASRELGQDHEVLRRKFLATRRRAEDMNQQLADAANAASPYLLFCQHKF
DVELADCLNALQKRMDNSRELEACCLRYHDLEPRYDETVSEFQSRVPTLEAQLVAASSSG
GDKAAQAEIDRLEAVIERKTRHFRALREAYERRLKVAYKTIDAHSPGLTPCIKTSGNLPS
AFAR
Download sequence
Identical sequences A0A080ZBT8 W2FXR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]