SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZG41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A080ZG41
Domain Number - Region: 16-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0199
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080ZG41
Sequence length 541
Comment (tr|A0A080ZG41|A0A080ZG41_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO65602.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_17145 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MASNFELDHAYLRQTVGAPLTEAMAQLAILQPEDPVEFLGNYLLKHVTNVETQQKLQKQK
QRPGLVTPRDNTQQDPVDTEQQQHQLEWEKVLEEEKQVHDQLHNEPSMVLVFQRFLEWIC
SMLNAEEAYIGRKCVDPQGNCVIHFIASSKHPQSTVVDNFVAQPTDEGDEEGVRRGIGVT
FDVFKEIVPTDEDGNPAVDTEGNALPASPPKFVHIENVLREPRVKFFGVPKLGALLARAG
QYKSYLHADVRNESNPEEPNVLEQWLVFSADTIGQARPFTKKEIDRFRHATELFLTTLEE
TERALYIKDNERCLSNDEPLLREFLVAFAAQVAVQEENLAAQLPGPPEGEELSEAAQQQR
AAKEAELRLSFLMTLLVSHIPTLSLASARVVPFKGFVLTTFAAALELLGYTRRELYNPAT
GQPSWDKISPLLGEAMLTESLNTFESSLETMRSLAEADSTSANGLRAVRKALPATPTAVA
QAKQNLAEIAKADVDTASPVASCFYMWSLAVVARAESITAMAEQAQQLEDETVAAAAGDD
A
Download sequence
Identical sequences A0A080ZG41 W2KEQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]