SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZMI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080ZMI8
Domain Number 1 Region: 209-272,302-369
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.11e-22
Family cAMP-binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 379-513
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-19
Family cAMP-binding domain 0.0097
Further Details:      
 
Domain Number 3 Region: 516-644
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-16
Family Regulator of G-protein signaling, RGS 0.0026
Further Details:      
 
Domain Number 4 Region: 17-91
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000995
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A080ZMI8
Sequence length 753
Comment (tr|A0A080ZMI8|A0A080ZMI8_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO67849.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_15266 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MGGAVSSAKYGSDNTKMVVDTLKKLPFMQMMDDRLLQELAVCFHVVKYAKGAIVKSDAAS
GFFVVVAEGSVDITTLLSTSNSKHLVSELLCQRKTGDYVSFVARDQLVAQMMCDDSEDAP
RTANEARKKLAALLELNRTIADPFVGCTLLKLNFDKFSKLRARMTVHSAGMKNTARFSGG
RKGKGGMGAMTTPEKLHLMGSIVESEVVNYLVEIPFLEKVEMTRLVMLANMCSYLYVRRG
EHICVEGEIGDRFFVCIKGTLQATLQVSLNAAQPTFTALKSGTKSERRTTIVALQEQVDG
AFTDKKIQALKRMGAGSYFGEISLVFKIPRVCSITALDDALLVYVDRAAFCNFLRVAPDA
AVVLLEHMRLNFLDTLIKQGCAFLNAIPPLKLQELSYMSEIVDYEFDTMIMRRGDQQTCF
YILLRGAVEINYGSTNTIVEAENDDAEGEVNVNTNELVLVHPGGYFGQEALLLNTGSLVN
VRCLDHCLVLKLMAENFHEFFSTLPELFAEFCIKCLREKTRLEHIMQHYEGHKLWAADCV
TRFRHHEVSLFEYIEDFKWQADISEDRNHERALVIYFKFLADTAPTPVNISSEVLAVLED
ELSSEGVGRDVFAAVRREILETMDDEAFQAFKSSRVFQEYLTMLHCPQAVYDSLTSEDEE
LLSMRSQTTLAVRRRTTRNDTTKTDLPAPKRAFGSGFSLVGDKFRRNSATVFAVANSTNT
VDADMLAPLGAQSRRKTKAAAGASRKLSTSFVF
Download sequence
Identical sequences A0A080ZMI8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]