SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZY06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080ZY06
Domain Number 1 Region: 18-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000131
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0057
Further Details:      
 
Weak hits

Sequence:  A0A080ZY06
Domain Number - Region: 69-107
Classification Level Classification E-value
Superfamily EF-hand 0.000103
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080ZY06
Sequence length 139
Comment (tr|A0A080ZY06|A0A080ZY06_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO71517.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_12151 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSSAIPPAANTNDPKVRAELYMASHGIKELFEGLGTLLLYHRPPNPREFLIQQLDEMRKA
KQEQRHVPFFEENDLKVMFAAFDIKDQGFITTEQYDQALLNLGIEKPTLRLPESVSTINQ
ALFIRSVTQEIKNASTSFM
Download sequence
Identical sequences A0A080ZY06 W2Z3H6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]