SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZYG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080ZYG6
Domain Number 1 Region: 39-66,180-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000262
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080ZYG6
Sequence length 279
Comment (tr|A0A080ZYG6|A0A080ZYG6_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO71677.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_12030 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSLASVAAVLQQQRHPGAFQDISTHISSFLGPPSCLSLSQACSFGSTKLLDWIWNSSCTS
VASRLSTWSVHNYLRSDPHYNRDQFVESLIAAVNRKDLAVVQWVFSHFSGLEVPEDVADA
ATRAGSLPVLKFLLANVVGHEGEYIRSKMKRKVGANDGEITAEEMESSKTRHLAHWDVGS
MMRIAVQEGNPEVVRYLHENMPVYDTEQFIGSSLLGENDEVAQILMPKGKCLLDYASTFR
SVKLVEMLLDCGYIQRDQGLAHSAIQILARFGRFDLMQQ
Download sequence
Identical sequences A0A080ZYG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]