SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080ZZ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080ZZ87
Domain Number 1 Region: 134-282
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000081
Family Regulator of G-protein signaling, RGS 0.0084
Further Details:      
 
Domain Number 2 Region: 3-134
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000397
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A080ZZ87
Sequence length 924
Comment (tr|A0A080ZZ87|A0A080ZZ87_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO71948.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_11811 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MDLTLDAVAKDAFRRDFFLRCFTEREAQALELRFAFLHRVRQYKRLVGRRDLLPRAAKEI
VASYLQQVESTNQLLLPPSAESLRSRVLNAVAAGYCPLDLFNGLETLVRDHMTRDAFPQF
LHSREYTELCDELRSRRELPLAEVLVDSRRTQFLMKFLTKNFPGDEGNIYFWVHVQTRFL
PLIQTTLFSVALFEEVQRHVRHVFNRYLVGETDTGEGAGSAATRVPETVRRATLQQIMKL
QSEPFSPPRYANLFRTAQDCVWEWLQTEVYPKFRASSLYVMLVVETEDLETDQQLRRLSE
HVQATAKKSATVRQERQSETILRVSSRKSEVQLKASAVLVPIKQPSTQNLWGQGAESNRH
SFDRVLTVPQLAQNGIHSVSVVSMGSSEIVFELFCTGDQYEAAAETHPTHLHFWRKNTVI
TPNGNALSPSGRPLSPTVPKPSFHFFVLPKDDIRDCSEVVTTRYLFGVCLTLWRQKSVPE
KPHTSTVDDGTTSPTNAISKGPCTAAQSYPQFFTVLTTEPMQKSSRRLLFQLASIGLKDL
TVDTVSRVVTSSFESSSNTPQLLSARFGGFSLQSNLRQVDISLSSVFKEISSQTFISILA
SILVGKSIILVSERSTALVSVAEAARELLKPFEWTHFYLPFCPVATSSELRDNGLFSEVN
TSPFFLGCEGVLSYQKKDSATDQRFRIRNSLYTTHKVSLHLQAPSTAEPNEYPPELLQTA
AIVIDIDSDDIYVPEKVEIPELPQSILRSLENMLSTALHSFRITHADSHLFGSSKTPSFI
EEMLDQSKKSSQSDDPSAPTQFESIELSLDDRARLALLWFLEALFGDVVYYFCSLHQNFT
VETQSPSADIDEFLLFEVDSFLDAHIELGCRDFFRQCFHTELFRNFILAQHMQFAFTNAG
VALESSESSLEHETLREALPDAFI
Download sequence
Identical sequences A0A080ZZ87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]