SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081A6Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081A6Z4
Domain Number 1 Region: 194-549
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-72
Family Protein kinases, catalytic subunit 0.0000047
Further Details:      
 
Domain Number 2 Region: 68-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.34e-17
Family Regulator of G-protein signaling, RGS 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081A6Z4
Sequence length 621
Comment (tr|A0A081A6Z4|A0A081A6Z4_PHYPR) AGC protein kinase {ECO:0000313|EMBL:ETO74655.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_09661 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MGAGASVPSDSNGSMRLQTPSRIVTAFLNLANKPHHAPLVAAKTQWKIAQPFPIGNGEVS
TNEQELLHVLHDPVGQKHIGSFAKKIMTSESFFCWVEIKEFREAPSSGYRKSMAKLIYRK
YIKNGSTMALGSITSDLIDHYDKKIGELEANGSTATVDFFDPLMANIVSDMCQNTFLRFK
ASPEYEAYKKDLKDTYNKVTIEDFEYLELLGSGGFGRVVHARKKSTGKHYAMKIQLKTGL
LDEHHDQLSQITSEKDILQICHNPFVLDMHYSFQTPAHAIIVTELVRGGDLGDALKSSRD
GYLHEDRVRLYAAEIGLALNHMHELGLIYRDLKPGNVLLGEDGHVILADMGLAAGFDPLK
LKKEETGDYRYTPVQPKLTRRKTTVGTRGYMAPEIISGKLVKRDQRPGYTFAVDFWSLGV
TLFELMCGFQPFSMHSSGNFFQEVANEEIFRLSPRTQHKIELQKMSQGVTFPLHLTRNAQ
DFLKRLLEVSTENRLGCNPEKGFSEFMEHPFFETVDWEKLMMKHIDPKFKPALPLLSDKK
IYNSYEHMMSHFDMRDKDFIRHDWYADPDPEMQKHFDTWDYISQYTLRAELGIAKELDET
NIPYKVLQLTGEDSKAKFTNK
Download sequence
Identical sequences A0A081A6Z4 A0A0W8DC80 V9F361 W2GSX7 W2Q7I8 W2X051 W2ZA86
XP_008906513.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]