SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081A9C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081A9C4
Domain Number 1 Region: 258-522
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-29
Family Ankyrin repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 116-197
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000418
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081A9C4
Sequence length 604
Comment (tr|A0A081A9C4|A0A081A9C4_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO75485.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_08941 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MEFSDDPLLWTSVVVVYRECLLKRSGEQLPHVVQHIDGFLDRTRSWTLSEVYERTSSLHC
MRLLADRRPAVDSLFREWEFSGVASLAAKRGDLTSLTWLADTAMPDGALSSAANAAAASG
QLEVLKWLVEEHKSRVHWGGLEWCEAIREGQNHVIKWLQMHSIPDEDAVWRLVVEAANAG
DLVLVQWLLSHNGSTIHAALRGAYNGHHCHILKWLATQCDALPPTYCVDAAVKDGDLEFL
QWLHENKLMNSLSGVVPISAASGHLNVLKWLHEQGEELTADCMDQAASGGHLDVIKWLDS
HECPATKLAMDGAAAAGYLDAVKWLHNQRTEGCSVSAMNGAAENGFLKVVKWLHSNRDEG
CGVSAMEKAAGNGHLDIVQWLHSHRSEGCTERAMDWAAKGGHLEVVKWLHLNRSEGCTTA
AMNWAAYGGHLETMKWLDENRSEGYTTKALCLAAAGGHLEVLKWLRSTKNERLTSDVVDM
AASSGHLQVLEWLHASGADECSPTAMRDAVLGHHIPVILFLYNNYQHDICEEGICFLRDE
WEDLEVRFVEMAQWLLDKYGDALEGVSFAVSRADWATNKWMEEHNMQQVDVEDKFIYWEY
SSAL
Download sequence
Identical sequences A0A081A9C4 V9F6T2 W2GUN3 W2X3Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]