SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081AQZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A081AQZ0
Domain Number - Region: 472-624
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000127
Family Regulator of G-protein signaling, RGS 0.008
Further Details:      
 
Domain Number - Region: 621-676,706-772
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000336
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081AQZ0
Sequence length 1358
Comment (tr|A0A081AQZ0|A0A081AQZ0_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO81301.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_04330 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSDDFERANVRTRPRRRSRSSGAVLNTPVTASSAESTPTPNTGISNGERTLLPSDVMELR
RSASADHVVGSGRRLSRSGFNPFSQSGGLSSSFRLNSAGSSFRAGAGVPVSSSALRSHAS
FLMMDIDSARQSVDAHTRALSFDDEDVMSDGGRLTRNMLGDSTSGSTGSERYRRASSLDS
SPPLPPDSTISAEEVIRESMASALSSSLYTDKDEFLLPHQRRSNAVGGNLNLSMAGTVSE
RDSLAMSRHSRDSLAFSFSSRSTFRRSTISEQMLYETDLFEPERELSARELSEVLSGSDE
DVNSYEVTSIKEEEEDVKLENAKSRWAQHVKLKARSFLYSTVAGNKNGASGSSNGAVTST
APTSAEIWANKQKQILAQMSSGSGFGAISGTSSAASSSSTHHHSILPPLPSFGQNSNGGA
KFQKWNRWMHDQYQHNFGKVMQRAFKDEVLQRQQQQFAFPTHQPTPDPTALISIEEVISN
PRMMRYYAAWLPDPADQSKLFFLCSFEEYRQFWCTLRANYQKKPFAKDDVLMLRTYGVKI
AMKYLAKNAQFPINGSADADGGSDEPPIVDSNKLRSIKRDLAAGGEDALRTFDDVAVKVK
RVLMFKFPEFRKTELYAEMQKTVEREVICLEDILMNHRFANFFWIFLFPHNYHREIALWL
DVEYEFKPAFRIYMSLLKSSGSSRSAALSSSTTNQRRERIEQAAYRCRRLLKYISQKYYA
GDAEMHTLSRTLVTSCARLQAEQDAILTKFSLIHLELYHRFLTSRAYAEFALYPKLSPED
EKDSIDDSMRLSALLLSYGLRAHHWAGGSSSSSSNGSTSASSSNARDETSAPKKKSLDSL
RTARSFEAISGVLTFEAVAVLVTAEEAENDTDENGSRVFEDPIELQVVQHPLPHDPTPHV
VDKSVENFLVPWSADPRHVVLTAPSCPAPLAFNFRMGDSSAGASAAELFAACVVLYKPAP
PLSRRALESSRLDSKSGCRWIPYGVCVLSKFPMVDLLRERLAEAYEFILELETIAAANSD
GKETIPHNGEHGFQLDKKVLAKLTRSVSKEHISQYHQPSPLPESPLLEASGLTPKATAAS
LLAALPRLDHSVRLLFDTLDVSTVLLVFTAALLENRILLVSSYLSVLMKVGESLRALMHP
LSWPHVYLPVLPRRLLQYLECPTPFIFGAEKQALDDAQRQLIEEGGDDLFAGAGEELLVV
DLDKGAVLRGEVPCALPDSVRFDLRDALYECLKPNVSRSDHVFAHHFPSKPLVFPEVAVR
GLFLRAVNKLIGDFGYHRYVWTDEFARKRTVFFDEASYLAASTPEMREFRTLFIATQAFS
EFAVTHHGFEEQPGQNCTGASRSSTTSSSSSVSSLPRK
Download sequence
Identical sequences A0A081AQZ0 W2LR11 W2XHL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]