SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081AQZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A081AQZ1
Domain Number - Region: 304-456
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000106
Family Regulator of G-protein signaling, RGS 0.008
Further Details:      
 
Domain Number - Region: 455-508,538-604
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000336
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081AQZ1
Sequence length 1190
Comment (tr|A0A081AQZ1|A0A081AQZ1_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO81302.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_04330 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLFLFYLASLDSSPPLPPDSTISAEEVIRESMASALSSSLYTDKDEFLLPHQRRSNAVGG
NLNLSMAGTVSERDSLAMSRHSRDSLAFSFSSRSTFRRSTISEQMLYETDLFEPERELSA
RELSEVLSGSDEDVNSYEVTSIKEEEEDVKLENAKSRWAQHVKLKARSFLYSTVAGNKNG
ASGSSNGAVTSTAPTSAEIWANKQKQILAQMSSGSGFGAISGTSSAASSSSTHHHSILPP
LPSFGQNSNGGAKFQKWNRWMHDQYQHNFGKVMQRAFKDEVLQRQQQQFAFPTHQPTPDP
TALISIEEVISNPRMMRYYAAWLPDPADQSKLFFLCSFEEYRQFWCTLRANYQKKPFAKD
DVLMLRTYGVKIAMKYLAKNAQFPINGSADADGGSDEPPIVDSNKLRSIKRDLAAGGEDA
LRTFDDVAVKVKRVLMFKFPEFRKTELYAEMQKTVEREVICLEDILMNHRFANFFWIFLF
PHNYHREIALWLDVEYEFKPAFRIYMSLLKSSGSSRSAALSSSTTNQRRERIEQAAYRCR
RLLKYISQKYYAGDAEMHTLSRTLVTSCARLQAEQDAILTKFSLIHLELYHRFLTSRAYA
EFALYPKLSPEDEKDSIDDSMRLSALLLSYGLRAHHWAGGSSSSSSNGSTSASSSNARDE
TSAPKKKSLDSLRTARSFEAISGVLTFEAVAVLVTAEEAENDTDENGSRVFEDPIELQVV
QHPLPHDPTPHVVDKSVENFLVPWSADPRHVVLTAPSCPAPLAFNFRMGDSSAGASAAEL
FAACVVLYKPAPPLSRRALESSRLDSKSGCRWIPYGVCVLSKFPMVDLLRERLAEAYEFI
LELETIAAANSDGKETIPHNGEHGFQLDKKVLAKLTRSVSKEHISQYHQPSPLPESPLLE
ASGLTPKATAASLLAALPRLDHSVRLLFDTLDVSTVLLVFTAALLENRILLVSSYLSVLM
KVGESLRALMHPLSWPHVYLPVLPRRLLQYLECPTPFIFGAEKQALDDAQRQLIEEGGDD
LFAGAGEELLVVDLDKGAVLRGEVPCALPDSVRFDLRDALYECLKPNVSRSDHVFAHHFP
SKPLVFPEVAVRGLFLRAVNKLIGDFGYHRYVWTDEFARKRTVFFDEASYLAASTPEMRE
FRTLFIATQAFSEFAVTHHGFEEQPGQNCTGASRSSTTSSSSSVSSLPRK
Download sequence
Identical sequences A0A081AQZ1 W2NUW9 W2XI99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]