SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081ARP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A081ARP6
Domain Number - Region: 92-114
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0301
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081ARP6
Sequence length 399
Comment (tr|A0A081ARP6|A0A081ARP6_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO81557.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_04178 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MGQAHSAPLDDAAQFRQMVLATYRGGVNALLSAFRPELRGLQISRATYLDIIMQEQTQLE
TLTDSLEREERLNELQDEKMEFFSAVEQGRLALGDTLLHIAVRLGHSDVLDFILLTDYNN
PQKTMVRPDTAASTMSIPPTVRNTAATNQVPLPPLPINTPNFKGDLPRDVTGDNCSLQLL
LATVDDVHEVFGSSYREEAKVHRLVRSLRRIWPLWMFEGQEVAALVRVLYDVRTSDPAFG
GLVRVAMAVAERFRVAVSRDGIHLAMSLLAGCDGDLHQARQKLTKEWNVERKSQALTTIF
QQWFPLYKSNGRRSDREEEETHAVFFDTAMITWLQIAQDLRLFGDIGLGSVEPPDAAALK
RYDSQVWQRRISPPPVSIGDLCVHINSLEGYLKLPHLSV
Download sequence
Identical sequences A0A081ARP6 W2JIC0 W2QJH2 W2ZTK0
XP_008901330.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]