SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081ATY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081ATY7
Domain Number 1 Region: 56-97
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081ATY7
Sequence length 308
Comment (tr|A0A081ATY7|A0A081ATY7_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO82348.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_03501 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSAPTSRLQAERLIASAYRIPLFENDGAGDNAAPTVSSGSKLRTLTRLPSRNSTSSSEFY
LQQSGVQFYVDDLVRQLQDKRPDQPAQFIASYFSAVAKGFNVKSRPYEYINGCLQNRVAF
LAQLQRSYAKIDHEIVLSVGDFTEMLRCQCRDLPTQLILQATCHLVEDQDGQRRASLQTF
LAAFSACFFFNEFLNKTHDIYNENSAAKDSNSIRSESVAHTVIADRVIARLRVVVQQNTY
APMSFVQYSSNASATSRFIIPPMIEVEKIVVKSSGFKEFCLLFYESPALAGYILNLQVAF
QKLTALAK
Download sequence
Identical sequences A0A081ATY7 W2ZWW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]