SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081AZU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081AZU2
Domain Number 1 Region: 1803-2058
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 9.81e-76
Family Rap/Ran-GAP 0.0000841
Further Details:      
 
Weak hits

Sequence:  A0A081AZU2
Domain Number - Region: 1579-1662
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000193
Family Regulator of G-protein signaling, RGS 0.0044
Further Details:      
 
Domain Number - Region: 400-481,614-765,899-971
Classification Level Classification E-value
Superfamily ARM repeat 0.00157
Family Diap1 N-terninal region-like 0.072
Further Details:      
 
Domain Number - Region: 136-200,397-547
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family Diap1 N-terninal region-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081AZU2
Sequence length 2086
Comment (tr|A0A081AZU2|A0A081AZU2_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO84403.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_01678 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MDSSKRVADAKAPSAELKRLAKFFASDRPPRKRLRTLLDFLKHTPGADGASGGNIAVAVQ
SLLSGSSKDAGGGGSGPEHAAAIAEFWADANNSTLVFGVVNDCVTELETLYAPHETAFRK
QRRKPLEAEDWSEVFEGLEVLLRNNGARLREGWNNNGLTMLFAKLLKRDNHAMIKKYAFR
CLALYTDATRSIQQLAAMPSTSTSSFQASRAGSIRLMSDGIEIDIDEDEDDRGTAMLSHT
MPSRKNMHLELLRESVDFSPYGGGSIMLPDKFLNEGVHVEGWMRPMPTQAEEPVDMLKFL
MDLSLEREDTHGKLSATGKPSGSSDRFIFWAELIMKFYMPLLYPKVCLKVKLKEEGDTLG
FFHHCPGSFQRVVARWVYKLRSKEDFMEVLWSRREFSEVIMETIRQRFAYRDTELVVDAI
KFYSGICTGAQFVPSGMKSQMNECSRAMISHVSQLFHPSVQLDDSKILLHCIELLELVSQ
RRLDDYTSTYLRKFVLSTIDNCVMLRDPGNRPVLTAMLSIVLHVWMHSAVVTKATGAQVW
MELTIAMRRWLVNPADTKAVGVELINCWKRELRFTSCLLMYVMDKGYSYLKVTPEGAKLL
PQDGKDEKAQGSGKTLRELKQGYLQSSANFLMMTVVDVSDATLLLDRVLHLIPPPTVSAL
TPSMHLSLTEGMLQLVELWIDSAIGAQRSHPSELQQISPSTVLALFGEWFLPACELEASD
FQNSRCIAIVALCKLCSVRCINAITRSHLTIVARVLFKGITSPSGVVVSTVLQKSSVLFS
MNLEGLNILVPAYLYAVDEIIIGNIWSRAEKSRVKSSEWNNELNAALDVVFAILELPKRF
PDQDFVRWKQKIMGVCGIDELPLMQDIIGEIPETLDDFHVIVGRILMRIAQLPFTDVVDI
KKRALWGLYCLVVMNLKSDNTGEHVIDPIHLSEWVVHLVDVCQNMDFSISMAALTILQDM
SDYHEEINAFEPSLVARIVMTLAVFAQQQVEEASIEVQAAMERMGAAETSSEGNGSGTKS
ASFTGSSLTSGTNLSSSAVRRGSDNPRASRVESNSADNSDAFSKLKSKLKPGQNAPASAP
SASTNSPVNPPSNSTAQREQEIPALRLIVQKTSAIFECLRFWIMHRTEVLQDTDVKKLIF
SAIEAALVGTLPDGEWQREVERARTLERRMSMPLLFLGLQMRASLDNEPGHVWLKCFEET
AVAAEGLLMHLLHHINGFPSPAGVDQMISDCSELNELDAARDKGDKDSPPAALSFVFMDS
IVFSVVGSLDSPCARFIVRDMTGLFTWEITPAVMTRGVHSLISAGSRSTSNSNGDSAPVE
RELTLQTDTLSSESLTLHRPTGAVQVEFKHTNEAGGICKTCGGEKPRTKSAPSDAKSGRI
KLEARQVSWEHEQNILSNNVCPIKSSYAFHEDGSASSANKENGDSKKKEKARTSEIEKMP
GSGNKDDRQERLERIAKQHEERNNTGAAAQPTPEPQKVVCHCPPQTESKFKRRTTTTICG
LFDMSINEPNVGSLDDERCLLDLVLDSIPMVFRDCGGDTTDKTLLGGRYSMMRYNLMDLT
PSTNPLLMDSAETPGFSFLQRLIHDEECYAQLKNFLTKDEHPGGKELVDFCDAVKKYERS
SVPTDRLGQASVIYWEFLSAEGGKKLIFPAAVVSDIQTQIHKAQAALRAVRAAPPEDSSD
VSFCLPGSLFQHAMTFVEYEGFEKSGLLDKYVAALDQPPAATSGKSSSTPSIPPQLALFD
SFSIMEVNARISHLALHKRSCDEQLVRMTKPGVAGGSRSVEVSNGSLKDSRVSALDICRL
FLSQAGLLPSPDGDSNKKSTLKLLEHGPKLERSLKHLDKSPTRETMKIGVIYVGKKQHTQ
QEILHNEKGSRAYELFLSQLGWKVNMQTHRGFVGGLDTNPKSLSNGESTLYYASSHSEVI
YHVVTMMPTKPSDPQQIDKKRHVGNDYVHIVWSDNATQNYDPSTITSHFNDVQIVIYPLR
KAQRGLFLIKIHTKDKVPPFGPLQSGMVVHQVDLARLVRQTSMNANRVCRSQTMLYVRPY
PTRKKLVDEIVERYAVEYKESQLLTMLFGNSSSTPAAASTPSGGAD
Download sequence
Identical sequences A0A081AZU2 V9FW16 W2JR23 W3A2S9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]