SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081BXZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081BXZ1
Domain Number 1 Region: 303-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000114
Family TSP-1 type 1 repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081BXZ1
Sequence length 519
Comment (tr|A0A081BXZ1|A0A081BXZ1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:GAK57196.1} KW=Complete proteome; Reference proteome OX=1499967 OS=Candidatus Vecturithrix granuli. GN=U27_04161 OC=Bacteria; Candidatus Vecturithrix.
Sequence
MKLRYILMAVCCMMVVSGLVTPAHTQIISGKDWTHQPGEGIEVELLGAGMGSKYGVEHNP
VTLTIANPENVVSIIAQVVAIETTAGQPPRVTFSSPQESFTLTTPSGTTTEDERYYEAVF
KPTNRITAQVLDIGFSPHSYTPRAFYLYVFRQTGVSQFVTGALIHESVYAKSLTPWASDP
YTAVFPIPTASSPRDIQVSFVISDLQSDCRIVDIEAEAGEIRHQETFSYSYLNDQPAVVT
NEALVVTRTLRNVPGEVQQVTMKVISPWDQARLCEADGDGKKNDCGDSVTISGFNVVVLG
KRVDCVVSEWGAWSECSAACGGGVQTLTREIVVFPEHGGAECPALSESQACNEQKCEEDV
SITKMQKTEDSDWTTDPLSVTWGEAISYMLTITNTFETAVDLMIGDALSSLVEYVGGLTA
TVDGTDVTLIGDIFEGWGFSGLGADETLSITFDVVVKDKDSVAAGSRIENTAWIYIDGDT
EKHVSKPVISNVVPEPATMFLFGIGLFGGLALLRRRRNR
Download sequence
Identical sequences A0A081BXZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]