SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081CCE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081CCE7
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.93e-33
Family Chaperone J-domain 0.00032
Further Details:      
 
Domain Number 2 Region: 256-344
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.88e-20
Family HSP40/DnaJ peptide-binding domain 0.00045
Further Details:      
 
Domain Number 3 Region: 138-208
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.35e-19
Family DnaJ/Hsp40 cysteine-rich domain 0.0000525
Further Details:      
 
Domain Number 4 Region: 113-146,212-255
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 7.85e-18
Family HSP40/DnaJ peptide-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081CCE7
Sequence length 411
Comment (tr|A0A081CCE7|A0A081CCE7_PSEA2) Chaperone regulator {ECO:0000313|EMBL:GAK64343.1} KW=Complete proteome; Reference proteome OX=84753 OS=Pseudozyma antarctica (Yeast) (Candida antarctica). GN=PAN0_005c2556 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Moesziomyces.
Sequence
MVKETKFYDLLEVSPTASEAELKKAYRKKALKEHPDKGGDPEKFKSITAAYEVLADSDKR
DLYDRFGEQGLEGGGMGGGMDPQDLFSQLFGGGGGGFFGGQGGRPRGPRKGKDLVHRVKV
SLEELYAGKVTKLALQKHVLCKKCDGRGGKEGAVKTCGGCNGQGIKVVLRQLGPMVQQMQ
QTCPECQGNGEIINAKDRCKECNGKKINQERKVLEVRIDKGMEDGQHITFKEEADQAPNT
IPGDVIIVVDEKPHPRFKRRKNDLYIDVEVDLLTALAGGKILIEHLDDHALSVEIPAGEV
IKPGEVKVLRGQGMPSYRHHELGDLYVNLSVAFPETIDLDAIPLLEKALPPRNALPKTKK
EVDVEDVQMDDLDEREARNAKPNGAGAQHMGMDDDDEDGPGGGPQVQCAQS
Download sequence
Identical sequences A0A081CCE7
XP_014657283.1.33630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]