SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081D3I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081D3I6
Domain Number 1 Region: 12-182
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000103
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081D3I6
Sequence length 188
Comment (tr|A0A081D3I6|A0A081D3I6_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:GAK73482.1} KW=Complete proteome OX=1220582 OS=Rhizobium rubi NBRC 13261. GN=RRU01S_44_00010 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium.
Sequence
MTMERSFQIVAQWLQENDPDKVPPFNQPATEDEIISAERRFGLELPDAVIDLYRLANGQP
SNAAGIEGSFVIMSLDEAVDAANFLNSEFPDGINADAPDDTFVEADHGVRSTWWSRHWIP
VMHNGGGDYLCADLDPAEGGSKGQIISYYHDEMFRSLVAPSVDSMLDDLASRLVSGRFRI
NDGMIEEI
Download sequence
Identical sequences A0A081D3I6
WP_081880204.1.34014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]