SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081ECL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081ECL8
Domain Number 1 Region: 171-308
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000562
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081ECL8
Sequence length 335
Comment (tr|A0A081ECL8|A0A081ECL8_STRFR) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KDS85156.1} KW=Complete proteome; Reference proteome OX=1906 OS=Streptomyces fradiae (Streptomyces roseoflavus). GN=SFRA_25825 OC=Streptomyces.
Sequence
MTTGRPGLGAPPSPRAGEHPAPPNTAYAGQIVHFPDPVRAARYPGGVRIDENGRPDFSPY
ARAAAEIADPPEGFGVDELRLTDYVSANAALHTAGHDLWGSLPPVATPHGWTWHHVPDGR
RMELVPVEVKALLRHHGGLATASVDQDKRGTRPLQETRPAHLGLPKGALSVTEAQVLGAE
EDLGYRLPGAYRSFLKAAGGCAPVGAALDAGLGLLVDQPFFTVRDEAAVNDLVYVNKCLR
DHLTKDYLGVAFVQGGILAVKVKGSALGSVWFCAYDDARDHDGLTVQERVEQLLLPCGDD
FDDFLRRLAGSPPELETVANLMVDGGFAYAVPVEG
Download sequence
Identical sequences A0A081ECL8
WP_043470477.1.15729 WP_043470477.1.33892 WP_043470477.1.51410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]