SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081I302 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081I302
Domain Number 1 Region: 77-180
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.7e-35
Family N-utilization substance G protein NusG, N-terminal domain 0.0000441
Further Details:      
 
Domain Number 2 Region: 211-267
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.23e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081I302
Sequence length 267
Comment (tr|A0A081I302|A0A081I302_9MYCO) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1324269 OS=Mycobacterium sp. TKK-01-0059. GN=K883_01053 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MTSFDGDPSAGDAVDLKETTEAAEVSDDTATSEVSEATTDEATADEAADAAGAPDEPAEE
VDPAVALKAELRSKPGDWYVIHSYAGYENKVKANLETRVQNLDVGDYIFQVEVPTEEVTE
IKNGQRKQVNRKVLPGYILVRMDLTDDSWAAVRNTPGVTGFVGATSRPSALTLDDVVKFL
LPRGATKKAAKGAATTATAAEAGGLERPAIEVDYEVGESVTVMDGPFATLPATISEVNGE
QQKLKVLVSIFGRETPVELTFSQVSKL
Download sequence
Identical sequences A0A081I302 A0A1B9CFH7 A0A222SBG7 I2AJC5 S4ZEJ6
gi|387877822|ref|YP_006308126.1| WP_008260910.1.101477 WP_008260910.1.11749 WP_008260910.1.13459 WP_008260910.1.15143 WP_008260910.1.21888 WP_008260910.1.37514 WP_008260910.1.38303 WP_008260910.1.40418 WP_008260910.1.76267 WP_008260910.1.97514 gi|523915878|ref|YP_008190303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]