SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081K6M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081K6M8
Domain Number 1 Region: 43-136
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000418
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081K6M8
Sequence length 242
Comment (tr|A0A081K6M8|A0A081K6M8_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KEI69804.1} KW=Complete proteome; Reference proteome OX=305900 OS=Endozoicomonas elysicola. GN=GV64_02760 OC=Endozoicomonaceae; Endozoicomonas.
Sequence
MDAGRGMLSSLLGYLYAPVDLVTRKVVCTEPITSFLLKGYVQKQQPENIKWMIDQGMTFD
KLHEHVMPQCEPLVIKAVKGGDYDSLKMLVEHGAPFNGGSFWTGGELLRDAFNAKKNQSE
IVEFLLDRSVFSAEKSVNLIDDPVAQEDVRSARQVALNDAINARCSDHILCLMLREVGAS
GVDRPEFTDEKCKSLYDKGLELELFEVSEDSGDSEDAKKILRIAVDKAHNKLEDTRLENR
QF
Download sequence
Identical sequences A0A081K6M8
WP_020584721.1.100946 WP_020584721.1.101077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]