SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081K7Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081K7Z9
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.88e-36
Family Chaperone J-domain 0.0000651
Further Details:      
 
Domain Number 2 Region: 135-212
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 3.53e-22
Family DnaJ/Hsp40 cysteine-rich domain 0.000032
Further Details:      
 
Domain Number 3 Region: 116-170,214-268
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.58e-22
Family HSP40/DnaJ peptide-binding domain 0.0058
Further Details:      
 
Domain Number 4 Region: 260-345
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.22e-21
Family HSP40/DnaJ peptide-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081K7Z9
Sequence length 380
Comment (tr|A0A081K7Z9|A0A081K7Z9_9GAMM) Chaperone protein DnaJ {ECO:0000256|HAMAP-Rule:MF_01152} KW=Complete proteome; Reference proteome OX=305900 OS=Endozoicomonas elysicola. GN=GV64_05560 OC=Endozoicomonaceae; Endozoicomonas.
Sequence
MAKRDYYEVLGVDRGASDKDIKKAYRRMAMKHHPDRNPGDKEAEESFKEINEAFEVLSDG
QKKAAYDQYGHAGVDPSMGGMGGAGGFAGGNFGDIFGDVFGDIFGAGGGRSRSSVQRGAD
LRYQLELSLEEAVRGVTKKIRIPTLVSCTECDGSGAKKGTQPVGCTTCGGIGQVRMQQGF
FSVQQTCPDCRGTGKMIKDPCHACHGEGRVQEYKTLSVKIPPGVDTGDRIRLAGEGEAGS
NGGPAGDLYVQVSVADHPIFQRDGKHLYCEVPITFVDAALGGELEVPTLEGRVKLKIPEE
TQTGKLFRLRGKGVIPVRGGSAGDLMCRVVVETPVKLTERQKELLKELEETFQKEGTGRQ
SPKKQSFFDGVKKFFDDMTS
Download sequence
Identical sequences A0A081K7Z9
WP_020581189.1.100946 WP_020581189.1.101077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]