SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081K9U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081K9U4
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.71e-39
Family SMI1/KNR4-like 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081K9U4
Sequence length 133
Comment (tr|A0A081K9U4|A0A081K9U4_9GAMM) Cell wall assembly protein {ECO:0000313|EMBL:KEI70920.1} KW=Complete proteome; Reference proteome OX=305900 OS=Endozoicomonas elysicola. GN=GV64_09350 OC=Endozoicomonaceae; Endozoicomonas.
Sequence
MEDVIDELRERALDVAVPLELPDEDQLVEVEEQILISLPYELREFLLQVSDVIYGSIEPV
TVTDPHSHTYLPEVAANAWAEGLPRELIPICEHNGEYYGISEEGEVVRWADGEVTDDSWP
SIWLWVRDVWMES
Download sequence
Identical sequences A0A081K9U4
WP_020580439.1.100946 WP_020580439.1.101077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]