SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081NEV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081NEV7
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily SET domain 7.06e-22
Family Viral histone H3 Lysine 27 Methyltransferase 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081NEV7
Sequence length 126
Comment (tr|A0A081NEV7|A0A081NEV7_9GAMM) Lysine methyltransferase {ECO:0000313|EMBL:KEQ16980.1} KW=Complete proteome; Reference proteome OX=1137799 OS=Endozoicomonas numazuensis. GN=GZ78_20365 OC=Endozoicomonaceae; Endozoicomonas.
Sequence
MLYVSFSGSKGRGVFTSKKIESNTVIERCPVLELPPQDLKHIDQTEVYNYYFSWGEKMDA
AAIALGLGSIYNHSYSPNALYRFDMEDRVIEFISIKKIRPNEEVTINYNGSPNDQSPLWD
GIQWEP
Download sequence
Identical sequences A0A081NEV7
WP_034839347.1.55067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]