SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081NT21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081NT21
Domain Number 1 Region: 25-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000353
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081NT21
Sequence length 139
Comment (tr|A0A081NT21|A0A081NT21_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KEQ21594.1} KW=Complete proteome; Reference proteome OX=1501230 OS=Paenibacillus tyrfis. GN=ET33_35340 OC=Paenibacillus.
Sequence
MRYNGIREIIEREPPKHQFEKISEAELEKEIIDGIPQDFVDFLKEIGQGTLDDEFFQFFG
CLVQADEFYDELYREEDHDELKDVLLFGRKCTGDAVGFWTTEDWSIVEVWHDDDLTLHPV
EEATFEEYINHLFTPKGEQ
Download sequence
Identical sequences A0A081NT21
WP_051776123.1.20468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]