SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081NVR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081NVR8
Domain Number 1 Region: 48-147
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.000000179
Family Cell wall binding repeat 0.01
Further Details:      
 
Domain Number 2 Region: 847-959
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000111
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081NVR8
Sequence length 1005
Comment (tr|A0A081NVR8|A0A081NVR8_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KEQ22541.1} KW=Complete proteome; Reference proteome OX=1501230 OS=Paenibacillus tyrfis. GN=ET33_22910 OC=Paenibacillus.
Sequence
MTENSNAFHPPYVVRFPFEKSLGLRYALIDVNGNLVREPNLLKVHNFTPNGKEGYITAAQ
DLNEKWGYLDQNGRWLIEPTLEDARIFGEEGMARFKKEGLWGYVDLNGEIKIQPQFEDAL
PFNAGLAAVRLHNGYAYIDCTGQVVIEGPFEGAGFFSPIGLAAVKKQGSSSCGIINTKGE
MGIPPQFADVSMYTSDGIAPARKGKLWGLIDTQGEWIVQPTYSRIEEFNEDGLAFFSDYS
DMMNIKKGYLNTNGDVVIEGMSISDQMVCGLAKQDVPYGGGIGFFDRTGTMVIPPQYAWA
DPFHKCGASVVLRKDKWGILTMDGQFREMPYLEPLTDHEGWVMGFYSGKGMAPFLIRKGE
VVYVDAAGREVCRLRVEETGNPQEHLLQLFNAEGRIAWQNEGERDTFLVESPFLRKQPAQ
HFEDNQYWEGDLTAAAQALLDAEPRDFYPYDWYERDVYDLSEEDEDEIDEHKKRGAMEVL
AGTYVSEEHYGHYPFLGEWERSAFEQYFSVIAERLSDSFGDPLPDASIMLRWGDNNLSKV
WEVNGKYLVLEWFTQYGDGDFVHRLWLASGYREDLEYDEEDDEHEYGSNEEGTEENDKTF
DLDQFERLVKAAQAHMDEEGHEEVLDLVFQMEELASDSTDVDVTHMSWIYDCKRHALYKL
GRVEEALETCREAIAYISPRMLFNYRPEPRQTLRACHNMLAQELMEHATTKEECLTAWEH
VKACFQAVEPNEGEAVFEYFYDTRALVLLKLSEFDPTEKAKAFAFLQRMQTIGSPYLRDE
PRLAKTINSAEYQVFVKSSHEVDREYVQAPALETAMEAVTRYHKAYETFSQFNSQVEKEF
GPILSLSFREDMIAKAEEELGFALPDALRQFMLVSGLVQEIYPELVPPMEIQGMFSLISD
VWGVRREFEERLTQKELYWLEVHCQICGLSQMDDHSQEYMYFTPGKGFGTFIYTRDDWDK
FEADVLRPLLAQEIPVETFDQMYSRKVTDQIKRMIEASRNSSAML
Download sequence
Identical sequences A0A081NVR8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]