SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081P0J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081P0J1
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily YdhG-like 1.44e-22
Family YdhG-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081P0J1
Sequence length 113
Comment (tr|A0A081P0J1|A0A081P0J1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KEQ24214.1} KW=Complete proteome; Reference proteome OX=1501230 OS=Paenibacillus tyrfis. GN=ET33_11015 OC=Paenibacillus.
Sequence
MSQEVIEFINAIKEPWQAEMSTRLREMILQTIPDVQERIQYKKPHFLKNGKYAAVISTSK
DAVSFTIFNPGGLEFPEGQFDGPPERKTIKLRSGQAADYDQVASLLGQASASL
Download sequence
Identical sequences A0A081P0J1
WP_036686509.1.20468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]