SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081P1Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081P1Z2
Domain Number 1 Region: 137-281
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.85e-59
Family AadK C-terminal domain-like 0.0000084
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.58e-50
Family AadK N-terminal domain-like 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081P1Z2
Sequence length 290
Comment (tr|A0A081P1Z2|A0A081P1Z2_9BACL) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KEQ24715.1} KW=Complete proteome; Reference proteome OX=1501230 OS=Paenibacillus tyrfis. GN=ET33_06435 OC=Paenibacillus.
Sequence
MRSEQEMMNLILDMAKNDERIRAVGMNGSRTNPNAPKDVFQDYDIVYIVHDLPAFIEDKQ
WIDRFGSRIIMQKPEEMKLIPPELDGKFPYLMLFADGNRIDLTLCPFEQKNNWNSGDKLA
VVLLDKDDCLPKLPAPTDEDYWVKRPSAKLFADCCNEFWWVSTYVAKGLWRQEMLYAQDH
LNVAVRPMLIRMLEWQVSIRTDFSISTGKNGKYLEKYLSRESWHELMSTFPDATYEGVWR
ALFAMGDLFRQTAQDVANSLDYEYPLEDDQRVTAYLKHVQNLAQDASEIF
Download sequence
Identical sequences A0A081P1Z2
WP_036684315.1.20468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]