SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081P871 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081P871
Domain Number 1 Region: 90-223
Classification Level Classification E-value
Superfamily Sortase 2.35e-35
Family Sortase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081P871
Sequence length 225
Comment (tr|A0A081P871|A0A081P871_9BACL) Sortase {ECO:0000313|EMBL:KEQ26894.1} KW=Complete proteome; Reference proteome OX=1501230 OS=Paenibacillus tyrfis. GN=ET33_29570 OC=Paenibacillus.
Sequence
MIKRTLPILCILLGIAIFLYPAVMDRYEIYRQQQMMDQWTEALKRIDQATETAVPKQNTL
NPVPVSAVVAPDPAPADSPPQPSNADPDPLEGKPIEGILIIDKIKLKLPIITDATVNNLK
LSVASIAGTAKAGAVGNYAIAGHRNFTYGKNFNRLDEVDKGDIIEVDTGKQQYRYQVQEK
QYVLPEDVWVLKGNGKDKEITLITCHPMENPTHRLIVKGKLIEKQ
Download sequence
Identical sequences A0A081P871
WP_036678222.1.20468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]