SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081PAH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081PAH9
Domain Number 1 Region: 47-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000301
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081PAH9
Sequence length 219
Comment (tr|A0A081PAH9|A0A081PAH9_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KEQ27702.1} KW=Complete proteome; Reference proteome OX=1501230 OS=Paenibacillus tyrfis. GN=ET33_13535 OC=Paenibacillus.
Sequence
MKQLEAALKKFIEIRNTYREYYTHCQFKEDEIILETNMFSNLIDKRIPLSPELKFFYDNC
TLKKAILEDGSILNGVSIDTGTSIAYISTPEMLYKRQLGFRWVGVKEPYREDDSWERAWV
IIADRNEDPIMVDTSKPGSPVLARYEMNDFTIIAKSFAEFLEVLSIVIEVTYKKYHGEIM
NDDGFEISEKFLDDLRIALGTILDDDTQIENILDYLYEL
Download sequence
Identical sequences A0A081PAH9
WP_036675548.1.20468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]