SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081PRK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081PRK8
Domain Number 1 Region: 128-269
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 8.63e-48
Family AadK C-terminal domain-like 0.0000745
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-36
Family AadK N-terminal domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081PRK8
Sequence length 273
Comment (tr|A0A081PRK8|A0A081PRK8_STRMT) Streptomycin adenylyltransferase family protein {ECO:0000313|EMBL:KEQ33331.1} KW=Complete proteome OX=28037 OS=Streptococcus mitis. GN=SK1126_1238 OC=Streptococcus.
Sequence
MRTETEMLDVILQTAQTLQVEAVAMSGSRTDTKAPKDEFQDYDVVFVVDDLDNLTSDLAW
LDSFGKRIIEQHNVLGNRRLYLMLFEDGNRIDLTLCPKEYIKEWVESEADFTVLEDTKGL
FAPYSPNPQRYWTSSASQIDFEKVCNEFWWVSAYVVKGICRKQVIYATDHLYSICQQELL
KVLAWLVASDRGKVDIGKNYKYLFNYLPAEKEKEFSNLLDFSSVEKLTQSLLATISLFHR
EAQDLAKKMDFDYDKEVAEKMIKYAEEKLQNTK
Download sequence
Identical sequences A0A081PRK8
WP_033681955.1.92999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]