SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081R5B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081R5B3
Domain Number 1 Region: 128-267
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.24e-49
Family AadK C-terminal domain-like 0.0000669
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.27e-37
Family AadK N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081R5B3
Sequence length 272
Comment (tr|A0A081R5B3|A0A081R5B3_STROR) Streptomycin adenylyltransferase family protein {ECO:0000313|EMBL:KEQ50386.1} KW=Complete proteome OX=1303 OS=Streptococcus oralis. GN=SK143_0437 OC=Streptococcus.
Sequence
MRTEPEMLDLILQTAKTLKVEAVALSGSRTNQKVQTDEFQDYDVVYVVDDLDNLTSDLAW
LDQFGARIIEQHNILGNRRLYLMLFEDGNRIDLTLCPKEYIKEWVESEADFTVLEDPKGL
FSPYSPNPQRYWTNPASQTDFEKACNEFWWVSAYVVKGICRKQVIYATDHLYEICQQELL
KVLAWQVASDNGTVDIGKNYKYLFQYLPAEKEKEFSALLDFSSVEKITQSLLSTMNLFHR
EAQILAQKMGFGYDMEVAEKMIEYAEERLLNR
Download sequence
Identical sequences A0A081R5B3 A0A1X1GV94
WP_042902167.1.28256 WP_042902167.1.73611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]