SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081RK92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081RK92
Domain Number 1 Region: 131-237
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 5.76e-20
Family TolA 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081RK92
Sequence length 238
Comment (tr|A0A081RK92|A0A081RK92_SPHCR) TonB family protein {ECO:0000313|EMBL:KEQ55615.1} KW=Complete proteome OX=46429 OS=Sphingobium chlorophenolicum. GN=BV95_00254 OC=Sphingomonadaceae; Sphingobium.
Sequence
MLPNSHDMNEEPRAGYGQPSAWSQRLGAGLAAASCCLLVLVALNANLSGRLRMTQPVQVS
RFRLFTPSPPSPPPSTLSRSRTDEARLSPERRPAHPPELATTGERGGPASSPIPAAPAIA
SPFAVAPVSRPPAPEPEVAPPQAQDDKKQSALAAYQRQLWARIAARKPAGIHLDGVATVR
FIVGADGALIAVELAGSSGNAALDRLALRTVRNAAPFPTPPMGVESEQLVFTIPFSFH
Download sequence
Identical sequences A0A081RK92 A0A120LTU5 A0A126R6W5 U2ZX45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]