SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081RPN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081RPN4
Domain Number 1 Region: 5-205
Classification Level Classification E-value
Superfamily Heme oxygenase-like 3.44e-42
Family PqqC-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081RPN4
Sequence length 210
Comment (tr|A0A081RPN4|A0A081RPN4_9ARCH) PqqC-like protein {ECO:0000313|EMBL:KEQ57157.1} KW=Complete proteome OX=1502293 OS=Marine Group I thaumarchaeote SCGC AAA799-N04. GN=AAA799N04_00295 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Marine Group I.
Sequence
MNIIKKIDEMIEERSLLKHPFYQAWSDGKLTKESLAGYSKEYFQLVKEVPSFMAPIIDKA
PESVVKELVENQQEESDHIKPWIAFAGELGISEEELLSYSGLPKTRKAVSDLNELMDTFE
SGACAMYAFEKEIPKISQTKLDGLAEFYGMTSEEATEYFKLHTEADIRHAASWRNILEKS
STDYDKLIEVAEKSISAQNLLLDSCFEEYC
Download sequence
Identical sequences A0A081RPN4 A0A087RV75 A0A087S0Z4 A0A087S8Q4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]