SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081RTY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081RTY4
Domain Number 1 Region: 129-194
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000000177
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0051
Further Details:      
 
Weak hits

Sequence:  A0A081RTY4
Domain Number - Region: 1-56
Classification Level Classification E-value
Superfamily CheY-like 0.000111
Family CheY-related 0.019
Further Details:      
 
Domain Number - Region: 11-27,59-78
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0902
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081RTY4
Sequence length 200
Comment (tr|A0A081RTY4|A0A081RTY4_PHOTE) Response regulator containing a CheY-like receiver domain and an HTH DNA-binding protein {ECO:0000313|EMBL:KER02137.1} KW=Complete proteome OX=1393735 OS=Photorhabdus temperata subsp. temperata Meg1. GN=MEG1DRAFT_03260 OC=Morganellaceae; Photorhabdus.
Sequence
MKILVVEECYYTRSGISEFLKKNDNVEDIEIVDSSSINEAIDIVAHFSPDIVLANLTHYC
HHSSYCSNLQKFITLIDNTRIYIYLNSAYPYCENYISLKNNTFILAKKSLPYLLNKLSKI
TLQEIQKHRMTIDECCSIFSPQEHKIIDYWMKEIPNYQISQKLNISNSTVYSHKRHITEK
IKVHNRIELCFIYNVFKYLY
Download sequence
Identical sequences A0A081RTY4 T0QGK7
WP_021326109.1.101547 WP_021326109.1.65573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]