SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081RV43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081RV43
Domain Number 1 Region: 12-279
Classification Level Classification E-value
Superfamily LigB-like 3.4e-52
Family LigB-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081RV43
Sequence length 292
Comment (tr|A0A081RV43|A0A081RV43_PHOTE) 3,4-dihydroxyphenylacetate 2,3-dioxygenase {ECO:0000313|EMBL:KER02546.1} KW=Complete proteome OX=1393735 OS=Photorhabdus temperata subsp. temperata Meg1. GN=MEG1DRAFT_02810 OC=Morganellaceae; Photorhabdus.
Sequence
MGKLALAAKITHVPSMYLSELPGKHHGCRQGAIDGHKEISRRCREMGVDTIIVFDTHWLV
NSAYHINCADHFSGIYTSNELPHFIRDMSYEYDGNPELGQMIAEEARNMGVRAQAHEIPS
LTLEYGTLVPMRYMNSDRHFKVISISAFCTVHAFEDSRRLGEAILKAIEKYDGTVAVLAS
GSLSHRFIDDQRAEEGMNSYTREFDEQMDRRVVQLWKEGKFKEFCKMLPEYADYCYGEGN
MHDTVMLLGLLGWDKYGGKVEFLTELFPSSGTGQVNAVFPLPDDITDEQATA
Download sequence
Identical sequences A0A081RV43 T0QM20 U7R4J8
WP_021324263.1.101547 WP_021324263.1.65573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]