SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081S0D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081S0D9
Domain Number 1 Region: 12-122
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 7.2e-40
Family Sigma2 domain of RNA polymerase sigma factors 0.00087
Further Details:      
 
Domain Number 2 Region: 200-284
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 1.2e-18
Family Sigma4 domain 0.011
Further Details:      
 
Weak hits

Sequence:  A0A081S0D9
Domain Number - Region: 127-188
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0288
Family FAT domain of focal adhesion kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081S0D9
Sequence length 285
Comment (tr|A0A081S0D9|A0A081S0D9_PHOTE) RNA polymerase sigma-32 factor {ECO:0000256|HAMAP-Rule:MF_00961} KW=Complete proteome OX=1393735 OS=Photorhabdus temperata subsp. temperata Meg1. GN=MEG1DRAFT_00938 OC=Morganellaceae; Photorhabdus.
Sequence
MAKEMQTLALVPQGSLEGYIRASNTYPMLTAEEEKELAERLHYQGDLDAAKKLILSHLRF
VVHVARSYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVEMVAKELGVTSKDVREMESRMSAQDM
AFDMSADDDSQEGLPIAPVLYLQDKASDFADGIEEDNWENHAADKLSVAIEGLDERSQDI
IRCRWLDDDNKSTLQELADKYGVSAERVRQLEKNAMKKLRVAIEA
Download sequence
Identical sequences A0A081S0D9 A0A0F7LQK7 T0P8A4
WP_021324317.1.101547 WP_021324317.1.12641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]