SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081XHT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081XHT9
Domain Number 1 Region: 8-87,126-185
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000118
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081XHT9
Sequence length 192
Comment (tr|A0A081XHT9|A0A081XHT9_STRTO) Uncharacterized protein {ECO:0000313|EMBL:KES03112.1} KW=Complete proteome; Reference proteome OX=55952 OS=Streptomyces toyocaensis. GN=BU52_32180 OC=Streptomyces.
Sequence
MSGAIALLREAFPVEVRHGPLGWESIQAWERRHGVVLPEPYRTFVAGIANSTDLGPPDEG
GLLPVGEKPDSWAVWEADRWMSPKPFDGTTARVPGQPFPLKEEWQWEYDYYDHTLHSSLL
HQTHQHGSVLLGSDRPGEYWTLVVTGPQRGLVWWLRDGSAAPYADSPPDQPEGDFLHWVR
DWHTGQGWWRAK
Download sequence
Identical sequences A0A081XHT9
WP_037940932.1.88502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]